Non-secretory ribonuclease (northern white-cheeked gibbon)
Protein
Dates
- Create:2017-04-15
- Modify:2025-01-17
Description
This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Possesses a wide variety of biological activities (By similarity).
- Non-secretory ribonuclease
- EC 4.6.1.18
- Eosinophil-derived neurotoxin
- RNase UpI-2
- Ribonuclease 2
- RNase 2
- Ribonuclease US
- Eosinophil Protein X
- RNS2 Neurotoxin
- Serum Eosinophil Protein X
- s-EPX
>sp|Q8SPY8|RNAS2_NOMLE Non-secretory ribonuclease (Run BLAST)
MVPKLFTSQICLLLLLGLMGVEGSLHAKPQQFTWAQWFEIQHINMTSQQCTNAMRVINNYQRRCKNQNTFLRTTFANVVNVCGNPNMTCPSNKTRKNCHQSGSQVPLIHCNLTTPSPQNISNCGYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlEosinophil-Derived Neurotoxinhttps://meshb.nlm.nih.gov/record/ui?ui=D047208
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
CONTENTS