Aquaporin-3 (house mouse)
Protein
Encoding Gene
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-28
Description
An aquaporin-3 that is encoded in the genome of mouse.
Aquaglyceroporins form homotetrameric transmembrane channels, with each monomer independently mediating glycerol and water transport across the plasma membrane along their osmotic gradient (PMID: 11880378, PMID: 12771381, PMID: 17429015, PMID: 19468303). Could also be permeable to urea (By similarity). Also participates in cell permeability to H2O2 and H2O2-mediated signaling (By similarity). In skin, transports glycerol to the epidermis and stratum corneum, where it maintains hydration, elasticity, and supports lipid biosynthesis for barrier repair (PMID: 11880378, PMID: 12771381). In kidney, contributes to the reabsorption of water, helping the body maintain proper fluid balance (PMID: 10737773).
- Aquaporin-3
- AQP-3
- Aquaglyceroporin-3
>sp|Q8R2N1|AQP3_MOUSE Aquaporin-3 (Run BLAST)
MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGPNGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEENVKLAHMKHKEQI
Highly accurate protein structure prediction with AlphaFold. Nature. 2021 Aug;596(7873):583-589. DOI:10.1038/s41586-021-03819-2. PMID:34265844; PMCID:PMC8371605
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- WikidataAquaporin 3https://www.wikidata.org/wiki/Q14905216
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS