dTTP/UTP pyrophosphatase (Vibrio vulnificus CMCP6)
Protein
Taxonomy
Dates
- Create:2017-04-15
- Modify:2024-12-28
Description
Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides into cellular nucleic acids.
- dTTP/UTP pyrophosphatase
- dTTPase/UTPase
- EC 3.6.1.9
- Nucleoside triphosphate pyrophosphatase
- Nucleotide pyrophosphatase
- Nucleotide PPase
>sp|Q8DCG8|NTPPA_VIBVU dTTP/UTP pyrophosphatase (Run BLAST)
MHKLVLASGSPRRKELLAQLGYTFDVVLPDIEECKAEQETAAEYVLRLSQQKAQAGLALVSESSIVVGSDTVVVCDGQVLEKPHHFADAQRMLTQLSDRRHQVMTAVTVVSAEKQHSIVVTTEVWFKKLTQEEIEQYWQSGEPCDKAGSYGIQGLGGRFVTRIEGSYSAVVGLPLYETDQLLHEFI
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS