Melanocyte-stimulating hormone receptor (Bolivian red howler monkey)
Protein
Dates
- Create:2017-04-15
- Modify:2025-01-27
Description
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Mediates melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), via regulation of cAMP signaling in melanocytes.
- Melanocyte-stimulating hormone receptor
- MSH-R
- Melanocortin receptor 1
- MC1-R
- MC1 Receptor
- Melanocyte Melanocortin Receptor
- Melanocortin Receptor 1
- Melanocortin-1 Receptor
- Receptor, Melanocortin-1
>sp|Q864G4|MSHR_ALOSA Melanocyte-stimulating hormone receptor (Run BLAST)
MPMQGAQRRLLGSLNSTPTATPNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVVAAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLEMAVILLLEAGALATRASVVQQLQNTIDVLTCSSMLCSLCFLGAIAVDRYVSIFYALRYHSIVTLPRARRAIAAIWVASVLSSTLFIAYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQLPAHQGFGLRGAATLTILLGIFFVCWGPFFLHLMLVVLCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAFRSQELCRTLKEVLLCSW
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlReceptor, Melanocortin, Type 1https://meshb.nlm.nih.gov/record/ui?ui=D044102
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
CONTENTS