Maleylacetate reductase (Sphingobium indicum UT26S)
Protein
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-18
Description
Catalyzes the NADH-dependent reduction of maleylacetate to beta-ketoadipate, a step in the degradation of gamma-hexachlorocyclohexane (gamma-HCH or lindane). Has an essential role in this assimilation pathway that allows S.japonicum UT26 to grow on gamma-HCH as the sole source of carbon and energy.
- Maleylacetate reductase
- MA reductase
- EC 1.3.1.-
>sp|Q5W9E3|LINF_SPHJU Maleylacetate reductase (Run BLAST)
MQFVYDPLPYRVIFGAGSVRRVADELSHVGSRALVLSTPEQAGSAQELAATLGDKAVGLFSKAVMHVPVATVDAAAAVARELDADCTVAIGGGSTVGLAKALSLRLDLPSLVVPTTYAGSEVTPIWGLTEDGIKTTGRDKKVLPKVVVYDPDLTLSLPAEMSIASGLNAIAHAMEGLYAFDGNPIVSLMAEESIRALARSLPLIKADPTDAKARGDALYGCWLAGSVLGAASVALHHKLCHTLGGTFDMPHAQTHTAVLPHAIAYNAPSVPEAMERASRALGGGDPATKLYELAVGLGAEMSLAKLGMPKDGIAKAAALAVANPYPNPRPITEEGIVQLLSRAVEGLPPITA
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS