KH domain-containing, RNA-binding, signal transduction-associated protein 2 (human)
- Create:2017-04-15
- Modify:2025-01-06
- KH domain-containing, RNA-binding, signal transduction-associated protein 2
- Sam68-like mammalian protein 1
- SLM-1
- hSLM-1
>sp|Q5VWX1|KHDR2_HUMAN KH domain-containing, RNA-binding, signal transduction-associated protein 2 (Run BLAST)
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- GlyGen
- Human Protein Atlas (HPA)LICENSEThe Human Protein Atlas is licensed under the Creative Commons Attribution-ShareAlike 3.0 International License for all copyrightable parts of our database.https://www.proteinatlas.org/about/licence
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Open TargetsLICENSEDatasets generated by the Open Targets Platform are freely available for download.https://platform-docs.opentargets.org/licenceKH RNA binding domain containing, signal transduction associated 2https://platform.opentargets.org/target/ENSG00000112232
- PharosLICENSEData accessed from Pharos and TCRD is publicly available from the primary sources listed above. Please respect their individual licenses regarding proper use and redistribution.https://pharos.nih.gov/aboutKH domain-containing, RNA-binding, signal transduction-associated protein 2https://pharos.nih.gov/targets/Q5VWX1
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Swiss Institute of Bioinformatics neXtProt
- WikidataKH RNA binding domain containing, signal transduction associated 2https://www.wikidata.org/wiki/Q21104959
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq