Galactoside alpha-(1,2)-fucosyltransferase 2 (human)
- Create:2017-04-15
- Modify:2025-01-17
- Galactoside alpha-(1,2)-fucosyltransferase 2
- Alpha(1,2)FT 2
- Fucosyltransferase 2
- GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 2
- SE2
- Secretor blood group alpha-2-fucosyltransferase
- Secretor factor
- Se
- Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT2
- 2.4.1.69
- Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT2
- 2.4.1.344
- Alpha-2-L-fucosyltransferase
- Alpha-2-fucosyltransferase
- Blood Group H Fucosyltransferase
- Blood Group H alpha-2-fucosyltransferase
- Fucosyltransferase 1
- Fucosyltransferase 2
- GDP-L-fucose-beta-D-galactosyl alpha-2-L-fucosyltransferase
- GDP-L-fucose-galactoside-2'-fucosyltransferase
- GDPFG-2-fucosyltransferase
- GDP-L-fucose-beta-D-galactoside 2-alpha-L-fucosyltransferase
- GDP-L-fucose-lactose fucosyltransferase
- Galactoside 2-alpha-L-fucosyltransferase 1
- Gal alpha1-2 fucosyltransferase
- Galactoside 2-alpha-L-fucosyltransferase 2
- Galactoside 2-fucosyltransferase
- Guanosine Diphosphofucose-glycoprotein 2-alpha-L-fucosyltransferase
- Secretor Blood Group alpha-2-fucosyltransferase
- beta-galactoside alpha-1,2-fucosyltransferase
- beta-galactoside alpha1,2-fucosyltransferase
>sp|Q10981|FUT2_HUMAN Galactoside alpha-(1,2)-fucosyltransferase 2 (Run BLAST)
MLVVQMPFSFPMAHFILFVFTVSTIFHVQQRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCSWTFYHHLRQEILQEFTLHDHVREEAQKFLRGLQVNGSRPGTFVGVHVRRGDYVHVMPKVWKGVVADRRYLQQALDWFRARYSSLIFVVTSNGMAWCRENIDTSHGDVVFAGDGIEGSPAKDFALLTQCNHTIMTIGTFGIWAAYLTGGDTIYLANYTLPDSPFLKIFKPEAAFLPEWTGIAADLSPLLKH
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlGalactoside 2-alpha-L-fucosyltransferasehttps://meshb.nlm.nih.gov/record/ui?ui=D000097631
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- BRENDA: Enzyme Functional DataLICENSEThe usage of the BRENDA data is licensed under Creative Commons Attribution License CC BY 4.0.https://www.brenda-enzymes.org/license.php
- ChEMBLLICENSEAccess to the web interface of ChEMBL is made under the EBI's Terms of Use (http://www.ebi.ac.uk/Information/termsofuse.html). The ChEMBL data is made available on a Creative Commons Attribution-Share Alike 3.0 Unported License (http://creativecommons.org/licenses/by-sa/3.0/).http://www.ebi.ac.uk/Information/termsofuse.htmlChEMBL Protein Target Treehttps://www.ebi.ac.uk/chembl/g/#browse/targets
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- Human Protein Atlas (HPA)LICENSEThe Human Protein Atlas is licensed under the Creative Commons Attribution-ShareAlike 3.0 International License for all copyrightable parts of our database.https://www.proteinatlas.org/about/licence
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Open TargetsLICENSEDatasets generated by the Open Targets Platform are freely available for download.https://platform-docs.opentargets.org/licencefucosyltransferase 2 (H blood group)https://platform.opentargets.org/target/ENSG00000176920
- PharosLICENSEData accessed from Pharos and TCRD is publicly available from the primary sources listed above. Please respect their individual licenses regarding proper use and redistribution.https://pharos.nih.gov/aboutGalactoside 2-alpha-L-fucosyltransferase 2https://pharos.nih.gov/targets/Q10981
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Swiss Institute of Bioinformatics neXtProt
- Wikidata
- Swiss Institute of Bioinformatics ENZYMELICENSECopyrighted by the SIB Swiss Institute of Bioinformatics and distributed under the Creative Commons Attribution (CC BY 4.0) License (https://creativecommons.org/licenses/by/4.0/).https://enzyme.expasy.org/enzyme.getEnzyme Classificationhttps://enzyme.expasy.org/
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer