PTS system galactitol-specific EIIC component (Escherichia coli K-12)
- Create:2017-04-15
- Modify:2025-01-19
- PTS system galactitol-specific EIIC component
- EIIC-Gat
- Galactitol permease IIC component
>sp|P69831|PTKC_ECOLI PTS system galactitol-specific EIIC component (Run BLAST)
MFSEVMRYILDLGPTVMLPIVIIIFSKILGMKAGDCFKAGLHIGIGFVGIGLVIGLMLDSIGPAAKAMAENFDLNLHVVDVGWPGSSPMTWASQIALVAIPIAILVNVAMLLTRMTRVVNVDIWNIWHMTFTGALLHLATGSWMIGMAGVVIHAAFVYKLGDWFARDTRNFFELEGIAIPHGTSAYMGPIAVLVDAIIEKIPGVNRIKFSADDIQRKFGPFGEPVTVGFVMGLIIGILAGYDVKGVLQLAVKTAAVMLLMPRVIKPIMDGLTPIAKQARSRLQAKFGGQEFLIGLDPALLLGHTAVVSASLIFIPLTILIAVCVPGNQVLPFGDLATIGFFVAMAVAVHRGNLFRTLISGVIIMSITLWIATQTIGLHTQLAANAGALKAGGMVASMDQGGSPITWLLIQVFSPQNIPGFIIIGAIYLTGIFMTWRRARGFIKQEKVVLAE
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- BRENDA: Enzyme Functional DataLICENSEThe usage of the BRENDA data is licensed under Creative Commons Attribution License CC BY 4.0.https://www.brenda-enzymes.org/license.php
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Wikidatapseudogene, galactitol-specific enzyme IIC component of PTS;transport; Transport of small molecules: Carbohydrates, organic acids, alcohols~PTS system galactitol-specific enzyme IIC encoded by: gatC b2092https://www.wikidata.org/wiki/Q50488963
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq