Exopolygalacturonase (Zea mays)
- Create:2017-04-15
- Modify:2025-01-11
- Exopolygalacturonase
- ExoPG
- EC 3.2.1.67
- Galacturan 1,4-alpha-galacturonidase
- Pectinase
- Endopolygalacturonase
- Pectin Depolymerase
- Pectinase
>sp|P35338|PGLR2_MAIZE Exopolygalacturonase (Run BLAST)
MACTDNAMRALFLLVLFCIVHGEKEESKGIDAKASGPGGSFDITKLGASGNGKTDSTKAVQEAWASACGGTGKQTILIPKGDFLVGQLNFTGPCKGDVTIQVDGNLLATTDLSQYKEHGNWIEILRVDNLVITGKGNLDGQGPAVWSKNSCTKKYDCKILPNSLVMDFVNNGEVSGVTLLNSKFFHMNMYQCKNMLIKDVTVTAPGDSPNTDGIHMGDSSGITITNTVIGVGDDCISIGPGTSKVNITGVTCGPGHGISIGSLGRYKDEKDVTDINVKDCTLKKTMFGVRIKAYEDAASVLTVSKIHYENIKMEDSANPIFIDMKYCPNKLCTANGASKVTVKDVTFKNITGTSSTPEAISLLCTAKVPCTGATMDDVNVEYSGTNNKTMAICTNAKGSTKGCLKELACF
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlPolygalacturonasehttps://meshb.nlm.nih.gov/record/ui?ui=D011096
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer