Microtubule-associated protein tau (cattle)
- Create:2017-04-15
- Modify:2025-01-19
- Microtubule-associated protein tau
- Neurofibrillary tangle protein
- Paired helical filament-tau
- PHF-tau
>sp|P29172|TAU_BOVIN Microtubule-associated protein tau (Run BLAST)
MAEPRQEFDVMEDHAQGDYTLQDQEGDMDPGLKESPLQTPADDGSEEPGSETSDAKSTPTAEDATAPLVDEGAPGEQAAAQAPAEIPEGTAAEEAGIGDTSNLEDQAAGHVTQARMVSKGKDGTGPDDKKTKGADGKPGTKIATPRGAAPPGQKGQANATRIPAKTTPTPKTSPATMQVQKKPPPAGAKSERGESGKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSAAKSRLQAAPGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- ChEMBLLICENSEAccess to the web interface of ChEMBL is made under the EBI's Terms of Use (http://www.ebi.ac.uk/Information/termsofuse.html). The ChEMBL data is made available on a Creative Commons Attribution-Share Alike 3.0 Unported License (http://creativecommons.org/licenses/by-sa/3.0/).http://www.ebi.ac.uk/Information/termsofuse.html
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license