Myelin basic protein (domestic guinea pig)
Protein
Dates
- Create:2017-04-15
- Modify:2025-01-18
Description
Is, with PLP, the most abundant protein component of the myelin membrane in the CNS. Has a role in both the formation and stabilization of this compact multilayer arrangement of bilayers. Each splice variant and charge isomer may have a specialized function in the assembly of an optimized, biochemically functional myelin membrane (By similarity).
- Myelin basic protein
- MBP
- Golli-MBP2 Protein
- Golli-MBP1 Protein
- HOG5 Protein
- HOG7 Protein
- MBP2 Protein
- MBP3 Protein
- MBP1 Protein
- MBP4 Protein
- Myelin Basic Protein, 18.5 kDa Isoform
- Myelin Basic Protein, Isoform 4
- Myelin Basic Protein, Isoform 5
- Myelin Basic Protein, 17.2 kDa Isoform
- Myelin Basic Protein, Isoform 6
- Myelin Basic Protein, 20.2 kDa Isoform
- Myelin Basic Protein, Isoform 3
- Myelin Basic Protein, Isoform 1
- Myelin Basic Protein, Isoform 7
- Myelin Basic Protein, 21.5 kDa Isoform
- Myelin Basic Protein, Isoform 2
>sp|P25188|MBP_CAVPO Myelin basic protein (Run BLAST)
ASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGSDRAAPKRGSGKDSHHAARTTHYGSLPQKSQRSQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRADYKSKGFKGAHDAQGTLSKIFKLGGRDSRSGSPMARR
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlMyelin Basic Proteinhttps://meshb.nlm.nih.gov/record/ui?ui=D004676
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
CONTENTS