Methylated-DNA--protein-cysteine methyltransferase (human)
Protein
Encoding Gene
Taxonomy
Dates
- Create:2017-04-15
- Modify:2024-12-16
Description
A methylated-DNA--protein-cysteine methyltransferase that is encoded in the genome of human.
Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated.
- Methylated-DNA--protein-cysteine methyltransferase
- EC 2.1.1.63
- 6-O-methylguanine-DNA methyltransferase
- MGMT
- O-6-methylguanine-DNA-alkyltransferase
>sp|P16455|MGMT_HUMAN Methylated-DNA--protein-cysteine methyltransferase (Run BLAST)
MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Highly accurate protein structure prediction with AlphaFold. Nature. 2021 Aug;596(7873):583-589. DOI:10.1038/s41586-021-03819-2. PMID:34265844; PMCID:PMC8371605
- Methylated-DNA-[protein]-cysteine S-methyltransferase, active site
- Methylguanine DNA methyltransferase, ribonuclease-like domain
- Methylated-DNA-[protein]-cysteine S-methyltransferase, DNA binding
- Methylated DNA-protein cysteine methyltransferase, DNA binding domain
- Winged helix-like DNA-binding domain superfamily
- Methylated DNA-protein cysteine methyltransferase domain superfamily
2 sites, 3 N-linked glycans (1 site), 1 O-linked glycan (1 site)
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- BRENDA: Enzyme Functional DataLICENSEThe usage of the BRENDA data is licensed under Creative Commons Attribution License CC BY 4.0.https://www.brenda-enzymes.org/license.php
- ChEMBLLICENSEAccess to the web interface of ChEMBL is made under the EBI's Terms of Use (http://www.ebi.ac.uk/Information/termsofuse.html). The ChEMBL data is made available on a Creative Commons Attribution-Share Alike 3.0 Unported License (http://creativecommons.org/licenses/by-sa/3.0/).http://www.ebi.ac.uk/Information/termsofuse.htmlChEMBL Protein Target Treehttps://www.ebi.ac.uk/chembl/g/#browse/targets
- DrugBankLICENSECreative Common's Attribution-NonCommercial 4.0 International License (http://creativecommons.org/licenses/by-nc/4.0/legalcode)https://www.drugbank.ca/legal/terms_of_use
- Therapeutic Target Database (TTD)
- Toxin and Toxin Target Database (T3DB)LICENSET3DB is offered to the public as a freely available resource. Use and re-distribution of the data, in whole or in part, for commercial purposes requires explicit permission of the authors and explicit acknowledgment of the source material (T3DB) and the original publication.http://www.t3db.ca/downloads
- GlyConnect
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- GlyGen
- Human Protein Atlas (HPA)LICENSEThe Human Protein Atlas is licensed under the Creative Commons Attribution-ShareAlike 3.0 International License for all copyrightable parts of our database.https://www.proteinatlas.org/about/licence
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- NCBI StructureLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- NCI Thesaurus (NCIt)LICENSEUnless otherwise indicated, all text within NCI products is free of copyright and may be reused without our permission. Credit the National Cancer Institute as the source.https://www.cancer.gov/policies/copyright-reuseNCI Thesaurushttps://ncit.nci.nih.gov
- Open TargetsLICENSEDatasets generated by the Open Targets Platform are freely available for download.https://platform-docs.opentargets.org/licenceO-6-methylguanine-DNA methyltransferasehttps://platform.opentargets.org/target/ENSG00000170430
- PharosLICENSEData accessed from Pharos and TCRD is publicly available from the primary sources listed above. Please respect their individual licenses regarding proper use and redistribution.https://pharos.nih.gov/aboutMethylated-DNA--protein-cysteine methyltransferasehttps://pharos.nih.gov/targets/P16455
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- RCSB Protein Data Bank (RCSB PDB)LICENSEData files contained in the PDB archive (ftp://ftp.wwpdb.org) are free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use. Users of the data should attribute the original authors of that structural data.https://www.rcsb.org/pages/policies
- Swiss Institute of Bioinformatics neXtProt
- WikidataO-6-methylguanine-DNA methyltransferasehttps://www.wikidata.org/wiki/Q21118735
- Swiss Institute of Bioinformatics ENZYMELICENSECopyrighted by the SIB Swiss Institute of Bioinformatics and distributed under the Creative Commons Attribution (CC BY 4.0) License (https://creativecommons.org/licenses/by/4.0/).https://enzyme.expasy.org/enzyme.getEnzyme Classificationhttps://enzyme.expasy.org/
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS