Granzyme B (human)
Protein
Encoding Gene
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-21
Description
A granzyme B that is encoded in the genome of human.
Abundant protease in the cytosolic granules of cytotoxic T-cells and NK-cells which activates caspase-independent pyroptosis when delivered into the target cell through the immunological synapse (PMID: 1985927, PMID: 3262682, PMID: 3263427). It cleaves after Asp (PMID: 1985927, PMID: 8258716). Once delivered into the target cell, acts by catalyzing cleavage of gasdermin-E (GSDME), releasing the pore-forming moiety of GSDME, thereby triggering pyroptosis and target cell death (PMID: 31953257, PMID: 32188940). Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -9 and -10 (CASP3, CASP9 and CASP10, respectively) to give rise to active enzymes mediating apoptosis (PMID: 9852092). Cleaves and activates CASP7 in response to bacterial infection, promoting plasma membrane repair (By similarity).
- Granzyme B
- EC 3.4.21.79
- C11
- CTLA-1
- Cathepsin G-like 1
- CTSGL1
- Cytotoxic T-lymphocyte proteinase 2
- Lymphocyte protease
- Fragmentin-2
- Granzyme-2
- Human lymphocyte protein
- HLP
- SECT
- T-cell serine protease 1-3E
- Cytotoxic T-Lymphocyte Associated 1 Protein
- Cytotoxic Serine Protease B
- Cytotoxic T-Lymphocyte Proteinase 1
- Fragmentin 2
- Granzyme A
- Granzyme B
- Granzyme K
- Granzyme C
- Granzyme-3
- Granzyme M
- Granzyme-Like Protein III
- Granzyme
- Hanukah Factor
- NK-Tryptase-2
- Natural Killer Cell Granule Tryptase-2
>sp|P10144|GRAB_HUMAN Granzyme B (Run BLAST)
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY
Highly accurate protein structure prediction with AlphaFold. Nature. 2021 Aug;596(7873):583-589. DOI:10.1038/s41586-021-03819-2. PMID:34265844; PMCID:PMC8371605
3 sites, 2 O-linked glycans (1 site)
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.html
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- BRENDA: Enzyme Functional DataLICENSEThe usage of the BRENDA data is licensed under Creative Commons Attribution License CC BY 4.0.https://www.brenda-enzymes.org/license.php
- ChEMBLLICENSEAccess to the web interface of ChEMBL is made under the EBI's Terms of Use (http://www.ebi.ac.uk/Information/termsofuse.html). The ChEMBL data is made available on a Creative Commons Attribution-Share Alike 3.0 Unported License (http://creativecommons.org/licenses/by-sa/3.0/).http://www.ebi.ac.uk/Information/termsofuse.htmlChEMBL Protein Target Treehttps://www.ebi.ac.uk/chembl/g/#browse/targets
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- GlyGen
- Human Protein Atlas (HPA)LICENSEThe Human Protein Atlas is licensed under the Creative Commons Attribution-ShareAlike 3.0 International License for all copyrightable parts of our database.https://www.proteinatlas.org/about/licence
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- IUPHAR/BPS Guide to PHARMACOLOGYLICENSEThe Guide to PHARMACOLOGY database is licensed under the Open Data Commons Open Database License (ODbL) https://opendatacommons.org/licenses/odbl/. Its contents are licensed under a Creative Commons Attribution-ShareAlike 4.0 International License (http://creativecommons.org/licenses/by-sa/4.0/)https://www.guidetopharmacology.org/about.jsp#licenseGuide to Pharmacology Target Classificationhttps://www.guidetopharmacology.org/targets.jsp
- Therapeutic Target Database (TTD)
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- NCBI StructureLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- NCI Thesaurus (NCIt)LICENSEUnless otherwise indicated, all text within NCI products is free of copyright and may be reused without our permission. Credit the National Cancer Institute as the source.https://www.cancer.gov/policies/copyright-reuseNCI Thesaurushttps://ncit.nci.nih.gov
- Open TargetsLICENSEDatasets generated by the Open Targets Platform are freely available for download.https://platform-docs.opentargets.org/licence
- PharosLICENSEData accessed from Pharos and TCRD is publicly available from the primary sources listed above. Please respect their individual licenses regarding proper use and redistribution.https://pharos.nih.gov/aboutGranzyme Bhttps://pharos.nih.gov/targets/P10144
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- RCSB Protein Data Bank (RCSB PDB)LICENSEData files contained in the PDB archive (ftp://ftp.wwpdb.org) are free of all copyright restrictions and made fully and freely available for both non-commercial and commercial use. Users of the data should attribute the original authors of that structural data.https://www.rcsb.org/pages/policies
- Swiss Institute of Bioinformatics neXtProt
- WikidataGranzyme Bhttps://www.wikidata.org/wiki/Q22677246
- Swiss Institute of Bioinformatics ENZYMELICENSECopyrighted by the SIB Swiss Institute of Bioinformatics and distributed under the Creative Commons Attribution (CC BY 4.0) License (https://creativecommons.org/licenses/by/4.0/).https://enzyme.expasy.org/enzyme.getEnzyme Classificationhttps://enzyme.expasy.org/
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
CONTENTS