GDSL esterase/lipase At1g59406 (thale cress)
- Create:2017-04-15
- Modify:2025-01-28
- GDSL esterase/lipase At1g59406
- EC 3.1.1.-
- Extracellular lipase At1g59406
>trembl|P0DI15|GDL27_ARATH GDSL esterase/lipase At1g59406 (Run BLAST)
MKIQILLFALVLIFVEANAATQGKNTTIPALIVFGDSIMDTGNNNNLPTLLKCNFPPYGKDYPGGFATGRFSDGRVPSDLIAEKLGLAKTLPAYMNPYLKPEDLLKGVTFASGGTGYDPLTAKIMSVISVWDQLINFKEYISKIKRHFGEEKAKDILEHSFFLVVSSSNDLAHTYLAQTHRYDRTSYANFLADSAVHFVRELHKLGARKIGVFSAVPVGCVPLQRTVFGGFFTRGCNQPLNNMAKQFNARLSPALDSLDKELDGVILYINVYDTLFDMIQHPKKYGFEVADRGCCGKGLLAISYLCNSLNPFTCSNSSAYIFWDSYHPSERAYQVIVDNLLDKYLSKVY
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- STRING: functional protein association networks
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq