Kappa-casein (house mouse)
Protein
Encoding Gene
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-17
Description
A kappa-casein that is encoded in the genome of mouse.
Kappa-casein stabilizes micelle formation, preventing casein precipitation in milk.
- AD beta-Casein
- Acetylated, Dephosphorylated beta-Casein
- Casein
- Casein A
- K-Casein
- Sodium Caseinate
- alpha(S1)-Casein A
- alpha(S1)-Casein B
- alpha(S1)-Casein C
- alpha(S1)-Casein
- alpha(S2)-Casein
- alpha-Caseins
- alpha-Casein
- beta-Casein
- beta-Caseins
- epsilon-Casein
- gamma-Caseins
- gamma-Casein
- kappa-Caseins
- kappa-Casein
>sp|P06796|CASK_MOUSE Kappa-casein (Run BLAST)
MMRNFIVVVNILALTLPFLAAEIQNPDSNCRGEKNDIVYDEQRVLYTPVRSVLNFNQYEPNYYHYRPSLPATASPYMYYPLVVRLLLLRSPAPISKWQSMPNFPQSAGVPYAIPNPSFLAMPTNENQDNTAIPTIDPITPIVSTPVPTMESIVNTVANPEASTVSINTPETTTVPVSSTAA
Highly accurate protein structure prediction with AlphaFold. Nature. 2021 Aug;596(7873):583-589. DOI:10.1038/s41586-021-03819-2. PMID:34265844; PMCID:PMC8371605
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.html
- BioGRIDLICENSEThe MIT License (MIT); Copyright Mike Tyers Labhttps://wiki.thebiogrid.org/doku.php/terms_and_conditions
- STRING: functional protein association networks
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- Protein OntologyLICENSEPRO is distributed under the Creative Commons CC-BY 4.0 license (https://creativecommons.org/licenses/by/4.0/).
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- WikidataCasein kappahttps://www.wikidata.org/wiki/Q21980363
- AlphaFold DBLICENSEAll of the data provided is freely available for both academic and commercial use under Creative Commons Attribution 4.0 (CC-BY 4.0) licence terms.https://alphafold.ebi.ac.uk/faq
CONTENTS