Rhodopsin (Sowerby's beaked whale)
Protein
Dates
- Create:2017-04-15
- Modify:2025-01-26
Description
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth (By similarity). Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling (By similarity).
>sp|O62793|OPSD_MESBI Rhodopsin (Run BLAST)
MNGTEGLNFYVPFSNHTGVVRSPFEYPQYYLAEPWQFSVLAAYMFLLIMLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVANLFMVLGGFTTTLYTSMHAYFIFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWIMALACAAPPLVGWSRYIPEGMQCSCGVDYYTPSPEVNNESFVVYMFVVHFSIPMVIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVVIMVVAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPSFFAKSSAIYNPVIYIMMNKQFRNCMLTTLCCGRNPLGDDEVSTTASKTETSQVAPA
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
CONTENTS