Ribonuclease K6 (talapoin)
Protein
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-27
Description
Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.
- Ribonuclease K6
- RNase K6
- EC 3.1.27.-
>sp|O46531|RNAS6_MIOTA Ribonuclease K6 (Run BLAST)
MVLCFPLLLLLLVLWGPVCLLHAWPKHLTRAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFRHDSFQNVAAVCDLLSIICKNRQHNCHQSSKPVNMTDCRLTSGKYPQCRHSAAAQYKFFIIACDPPQKSDPPYKLVPVHLDSIL
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- GlyCosmos Glycoscience PortalLICENSEAll copyrightable parts of the datasets in GlyCosmos are under the Creative Commons Attribution (CC BY 4.0) License.https://glycosmos.org/license
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
CONTENTS