Proline--tRNA ligase (Variovorax paradoxus S110)
- Create:2017-04-15
- Modify:2025-01-20
- Proline--tRNA ligase
- EC 6.1.1.15
- Prolyl-tRNA synthetase
- ProRS
>sp|C5CXW9|SYP_VARPS Proline--tRNA ligase (Run BLAST)
MKASRFFVSTLKEAPADAEVASHRLMMRAGMIKKLGTGIYTYMPMGLRVIRKVEAIVREEMNRAGAVELTMPVVQPAEFWQETGRFDKMGPELLRIKDRHDRDFVVQPTSEEVVTDIARQEIRSYKQLPKNFYQIQTKFRDERRPRFGLMRGREFIMKDAYSFDRDLDAAKASYQAMADAYRRIFDRFGLRYRAVAADSGAIGGDLSEEFQVIAATGEDAIVYCPGSDYAANMEKAEALAPAGPRPAAAKALEKTPTPGKSTCADVAELLGVPLSTTVKSLVLATDILDEAGNPKGSQVWLLLLRGDHDMNEIKVGKVPGLDKGFRFATLAEIDDHFGCKPGYLGPLNLKKPVRLVADREVMVMADWITGANEVDFHMTGVNWGRDLPEPELVADLRNVVAGDASPDGKGVLAIERGIEVGHVFVLGTKYSKDMNATYLDEAGKPQFLEMGCYGIGITRLPAAAIEQNHDERGIIWPDALAPFTVVVCPIGMDRSPEVKVAAEALYEQLLAAGVDVLLDDRGERPGAMFADWELIGVPHRVVISDRGLKEGQLEYQHRRDTAATKVPAAGIAEFIAGKFAQ
- Aminoacyl-tRNA synthetase, class II (G/ P/ S/T)
- Proline-tRNA ligase, class IIa
- Anticodon-binding
- Prolyl-tRNA synthetase, class IIa, bacterial-type
- Aminoacyl-tRNA synthetase, class II
- YbaK/aminoacyl-tRNA synthetase-associated domain
- Prolyl-tRNA synthetase, class IIa, type 1
- Prokaryote proline-tRNA ligase core domain
- Anticodon-binding domain superfamily
- YbaK/aminoacyl-tRNA synthetase-associated domain superfamily
- Proline--tRNA ligase, anticodon binding domain
- Class II Aminoacyl-tRNA synthetase/Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL)
- Proline-tRNA synthetase
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer