Methylthioribose-1-phosphate isomerase (Gemmatimonas aurantiaca T-27)
- Create:2017-04-15
- Modify:2025-01-19
- Methylthioribose-1-phosphate isomerase
- M1Pi
- MTR-1-P isomerase
- EC 5.3.1.23
- S-methyl-5-thioribose-1-phosphate isomerase
>sp|C1A6J9|MTNA_GEMAT Methylthioribose-1-phosphate isomerase (Run BLAST)
MPVPPLPLHVPAVGWSPDLRALRILDQRLLPGAQEVRDLVQLEEIVEAIRTLAVRGAPAIGVAAAIGLVVALEVDSGGQETRARALLADYAARLQRARPTAVNLGWAIDRLVRTAHRTAVGSMLAALRAEAEAIRAEDVAMCEAIGQHGLAVVPDGARVLTHCNAGALATAGIGTALAPLYMAHARGRALTVYADETRPLRQGARLTAWELSRAGISVSVLPDGAAASLLSQGLVDLVIVGADRIAANGDVANKVGTYGVALAAAAHHVPFYVAAPGSTIDPHTATGRDIVIEHRDADELGELPPGVPAWNPAFDVTPRALIRGYITDRGFVEPPFTLADYAGR
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer