Dermonecrotic toxin LspiSicTox-betaIE3i (Loxosceles spinulosa)
Protein
Taxonomy
Dates
- Create:2017-04-15
- Modify:2025-01-21
Description
Dermonecrotic toxins cleave the phosphodiester linkage between the phosphate and headgroup of certain phospholipids (sphingolipid and lysolipid substrates), forming an alcohol (often choline) and a cyclic phosphate (By similarity). This toxin acts on sphingomyelin (SM) (By similarity). It may also act on ceramide phosphoethanolamine (CPE), lysophosphatidylcholine (LPC) and lysophosphatidylethanolamine (LPE), but not on lysophosphatidylserine (LPS), and lysophosphatidylglycerol (LPG) (By similarity). It acts by transphosphatidylation, releasing exclusively cyclic phosphate products as second products (By similarity). Induces dermonecrosis, hemolysis, increased vascular permeability, edema, inflammatory response, and platelet aggregation (By similarity).
- Dermonecrotic toxin LspiSicTox-betaIE3i
- EC 4.6.1.-
- Phospholipase D
- PLD
- Sphingomyelin phosphodiesterase D
- SMD
- SMase D
- Sphingomyelinase D
- Lecithinase D
- Phosphatidylcholine Phosphohydrolase
>sp|C0JB44|B1T1_LOXSN Dermonecrotic toxin LspiSicTox-betaIE3i (Run BLAST)
FALAHMVNDFDILKSYLDEGANGVETDITFSDEGEPEYAFHGVPCDCKRWCRRTVGFNEYLQHVRDLSTPGNPKFREHFIAIVLDLKLNGLSQEALAHGGMRLADKLIAYYWAHGRNATRITFIVSVPKTSEKVFLKTFLEEIKAVGYDDMLSKVAFDFTDNGDFSETQKVFEGLGIHEHIWASDGITNCIPMLFRGTSRLEDLIRQRDVPGYKYISKVYAWTYDKETSVVKALELGVDGVMTNYADFVIGIINKPEHSSKYRLATYQDNPFEKFVKSA
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlPhospholipase Dhttps://meshb.nlm.nih.gov/record/ui?ui=D010739
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS