Replication factor C (zebrafish)
- Activator 1 Protein
- Activator 1 Protein, 36 kDa Subunit
- Activator 1 Protein, 145 kDa Subunit
- Activator 1 Protein, 38 kDa Subunit
- Activator 1 p40
- Activator 1 Protein, 40 kDa Subunit
- Activator 1 Protein, 37 kDa Subunit
- Replication Factor C, Subunit 1
- Replication Factor C, Subunit 2
- Replication Factor C
- Replication Factor C, Subunit 3
- Replication Protein C, Subunit 1
- Replication Factor C, Subunit 5
- Replication Protein C, Subunit 3
- Replication Factor C, Subunit 4
- Replication Protein C, Subunit 2
- Replication Protein C, Subunit 4
- Replication Protein C, Subunit 5
>trembl|A0A0R4IAU3|A0A0R4IAU3_DANRE Replication factor C (Run BLAST)
MQAFLKGSSSQSVKAQKPSSSSSSGGEKKQRAVPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELYGPDLYRQRVLELNASDERGIQVVREKVKRFAQLTVAGTRPDGKTCPPFKIIILDEADSMTSAAQAALRRTMEKESRTTRFCLICNYVSRIIEPLTSRCSKFRFKPLANDVQQERILEICRKENLKYTTEIIQCLRQKQQLDMTAAATALHSVMHIKSVLHIVDMTLLFIRGVVPPKVIQSLLHICYKGTFEKLEVAVKDMIDQGYAATNLLNQLHDVIIEEQLSDKQKSVITEKMAEVDKCLADGADEYLQLLSLCSVIMQQATQNT
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- Medical Subject Headings (MeSH)LICENSEWorks produced by the U.S. government are not subject to copyright protection in the United States. Any such works found on National Library of Medicine (NLM) Web sites may be freely used or reproduced without permission in the U.S.https://www.nlm.nih.gov/copyright.htmlReplication Protein Chttps://meshb.nlm.nih.gov/record/ui?ui=D051818