Molybdenum cofactor guanylyltransferase (Rhodobacter capsulatus)
Protein
Taxonomy
Dates
- Create:2017-04-15
- Modify:2024-12-13
Description
Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine dinucleotide (Mo-MGD) cofactor.
- Molybdenum cofactor guanylyltransferase
- MoCo guanylyltransferase
- EC 2.7.7.77
- GTP:molybdopterin guanylyltransferase
- Mo-MPT guanylyltransferase
- Molybdopterin guanylyltransferase
- Molybdopterin-guanine dinucleotide synthase
- MGD synthase
>sp|Q9X7K0|MOBA_RHOCA Molybdenum cofactor guanylyltransferase (Run BLAST)
MRIAGIILAGGQGRRMGREKALVPLSGVPLIARVLALAPQVEAVAISANGDPGRFGLGLPVLPDRPGESGLGPMAGIRAGLDWAAGIGAEALVSTATDTPFLPEDLVERLAAAAPAHAQSFGRDHYTAALWRVATVPRIDALFAADERRIARLSGGAVAVPFDTTPDPFANLNTPEDLARAEDRLRQNAP
- NCBI ProteinLICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- PubChem
- IntAct Molecular Interaction DatabaseLICENSECreative Commons Attribution 4.0 International (CC BY 4.0) Licensehttps://www.ebi.ac.uk/intact/about#license_privacy
- InterProLICENSEAll of the InterPro, Pfam, PRINTS and SFLD downloadable data provided on the InterPro website is freely available under CC0 1.0 Universal (CC0 1.0) Public Domain Dedication.https://www.ebi.ac.uk/interpro/about/license/
- NCBI Conserved Domains (CDD)LICENSENCBI Website and Data Usage Policies and Disclaimershttps://www.ncbi.nlm.nih.gov/home/about/policies/
- UniProtLICENSEWe have chosen to apply the Creative Commons Attribution (CC BY 4.0, http://creativecommons.org/licenses/by/4.0/) License to all copyrightable parts of our databases.https://www.uniprot.org/help/license
- Rhea - annotated reactions databaseLICENSERhea has chosen to apply the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0/). This means that you are free to copy, distribute, display and make commercial use of the database in all legislations, provided you credit (cite) Rhea.https://www.rhea-db.org/help/license-disclaimer
CONTENTS