Bookmark and Share
3-phosphoinositide-dependent protein kinase 1.. [gi:4505695] - Target BioActivity Data
Also known as: 3-phosphoinositide-dependent protein kinase 1 isoform 1 [Homo sapiens].
Filters: All Data » Active      
Filter selected
BioActivity Outcomes:
Active(167)
 
 
BioAssay Types:
Literature(160)
 
 
Confirmatory(1)
 
 
BioActivity Types:
IC50(136)
 
 
Kd(17)
 
 
Substance Types:
Chemical(167)
 
 
Data download

Chemical Probe    Active    Inactive    Inconclusive    Unspecified   

Total Bioassays: 33    Data Row: 167   Total Pages: 4   Display: Page     
Sort: [Click the result table header to sort]
#StructureSubstanceCompoundActivityBioAssayLinks
OutcomeTypeValue [μM]
1
[SID103243222]
[CID44299148]
Kd 0.0017Binding constant for full-length PDPK1 [AID435189, Type: Literature]
View
2
[SID103243222]
[CID44299148]
Kd 0.0017Binding constant for PDPK1 kinase domain [AID624876, Type: Literature]
View
3
[SID163339605]
[CID10347359]
IC50 0.0023Displacement of [gamma33P]ATP from human TBK1 expressed in insect sf21 cells measured for 30 mins [AID729483, Type: Literature]
View
4
[SID103536234]
[CID11738018]
IC50 0.003Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
5
[SID103749805]
[CID25060409]
IC50 0.003Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
6
[SID103749823]
[CID46192858]
IC50 0.003Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
7
[SID103749845]
[CID46192989]
IC50 0.003Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
8
[SID164133368]
[CID71717270]
Kd 0.0034Binding constant for PDPK1 kinase domain [AID624876, Type: Literature]
View
9
[SID103749803]
[CID46192856]
IC50 0.005Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
10
[SID103524347]
[CID11161844]
IC50 0.005Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
11
[SID103524347]
[CID11161844]
IC50 0.006Inhibition of PDK1 (unknown origin) [AID729480, Type: Literature]
View
12
[SID103749804]
[CID25060410]
IC50 0.006Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
13
[SID103749806]
[CID46192857]
IC50 0.006Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
14
[SID103749869]
[CID46193129]
IC50 0.006Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
15
[SID103749936]
[CID46193132]
IC50 0.006Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
16
[SID103749894]
[CID46193131]
IC50 0.008Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
17
[SID103749895]
[CID25060411]
IC50 0.008Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
18
[SID103749826]
[CID44608012]
IC50 0.008Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
19
[SID103749937]
[CID46193133]
IC50 0.009Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
20
[SID131274687]
[CID54581311]
IC50 0.009Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA [AID592183, Type: Literature]
View
21
[SID103536235]
[CID23647627]
IC50 0.009Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
22
[SID163339605]
[CID10347359]
IC50 0.0095Inhibition of human IKKepsilon expressed in insect sf21 cells using MBP as substrate measured for 30 mins [AID729482, Type: Literature]
View
23
[SID103536236]
[CID21957818]
IC50 0.01Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
24
[SID103524331]
[CID23647599]
IC50 0.01Inhibition of AKT phosphorylation in PC3 cells [AID291127, Type: Literature]
View
25
[SID131272728]
[CID46215815]
IC50 0.01Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence-based spectrophotometry [AID641893, Type: Literature]
View
26
[SID131272728]
[CID46215815]
IC50 0.01Inhibition of recombinant full length PDK1 (unknown origin) expressed in insect cells assessed as inhibition of Akt activation measured for 30 mins in presence of [gamma32P-ATP] [AID729481, Type: Literature]
View
27
[SID163339605]
[CID10347359]
IC50 0.011Inhibition of human Aurora B expressed in insect sf21 cells using LRRLSLGLRRLSLGLRRLSLGLRRLSLG peptide as substrate measured for 30 mins [AID729484, Type: Literature]
View
28
[SID163339605]
[CID10347359]
IC50 0.011Displacement of [gamma33P]ATP from human PDK1 expressed in insect sf21 cells measured for 30 mins [AID729485, Type: Literature]
View
29
[SID103749867]
[CID46192992]
IC50 0.013Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
30
[SID103749824]
[CID46192859]
IC50 0.014Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
31
[SID103536191]
[CID11461275]
IC50 0.014Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
32
[SID103749846]
[CID46192991]
IC50 0.015Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
33
[SID103749893]
[CID46193130]
IC50 0.015Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
34
[SID103749844]
[CID44620952]
IC50 0.017Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
35
[SID103749825]
[CID46192860]
IC50 0.018Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
36
[SID103524308]
[CID11311693]
IC50 0.018Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
37
[SID131274687]
[CID54581311]
IC50 0.019Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human PC3 cells by ELISA [AID592184, Type: Literature]
View
38
[SID103524328]
[CID23647598]
IC50 0.02Inhibition of AKT phosphorylation in PC3 cells [AID291127, Type: Literature]
View
39
[SID103749868]
[CID25060675]
IC50 0.021Inhibition of human GST-tagged-PDK1 expressed in HEK293 cells [AID477040, Type: Literature]
View
40
[SID131278743]
[CID51354613]
IC50 0.022Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA [AID592183, Type: Literature]
View
41
[SID131272729]
[CID51354036]
IC50 0.024Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA [AID592183, Type: Literature]
View
42
[SID164129104]
[CID71716356]
IC50 0.0265Inhibition of PDK1 (unknown origin) [AID729480, Type: Literature]
View
43
[SID103536192]
[CID23647623]
IC50 0.029Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
44
[SID103694292]
[CID657138]
IC50 0.03Inhibition of N terminal His-tagged human recombinant PDK1 using H2NARRRGVTTKTFCGT peptide as substrate assessed as substrate phosphorylation after 4 hrs by phosphorimager analysis in presence of [gamma-32P]ATP [AID729487, Type: Literature]
View
45
[SID131272729]
[CID51354036]
IC50 0.03Inhibition of PDK1-mediated RSK phosphorylation at Ser221 residue in human PC3 cells by ELISA [AID592184, Type: Literature]
View
46
[SID103572939]
[CID11234514]
IC50 0.034Inhibition of PDK1 (unknown origin) [AID729480, Type: Literature]
View
47
[SID103536193]
[CID23647624]
IC50 0.034Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
48
[SID136932487]
[CID56834890]
IC50 0.05Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human A549 cells after 2 hrs by ELISA [AID641965, Type: Literature]
View
49
[SID103536179]
[CID11323104]
IC50 0.055Inhibition of PDK1 mediated cAKT2 phosphorylation by AKT2 activation assay [AID299513, Type: Literature]
View
50
[SID131280779]
[CID51354035]
IC50 0.057Inhibition of PDK1-mediated AKT phosphorylation at Thr308 residue in human PC3 cells by ELISA [AID592183, Type: Literature]
View